PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008228998.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family bHLH
Protein Properties Length: 224aa    MW: 25858.2 Da    PI: 6.3169
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008228998.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH32.22e-103280555
                    HHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
             HLH  5 hnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55
                       +E++RR++++  +++L +llP +  ++++ +s  +   +A++YIksL+
  XP_008228998.1 32 RRVIEKNRRNQMKVLYSKLNSLLPRQ--NSQEPPSLPDQIDEAINYIKSLE 80
                    5689*********************6..26666****************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474596.28E-122597IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000832.18E-52584No hitNo description
PROSITE profilePS5088811.8582779IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.101.1E-93097IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003532.0E-43385IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.2E-63380IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 224 aa     Download sequence    Send to blast
MGSFVANLEE RDHQIPMDHN QGSQSSSTKV ERRVIEKNRR NQMKVLYSKL NSLLPRQNSQ  60
EPPSLPDQID EAINYIKSLE SKLQKSKEKR DSLKGNRKRS HTACTNFDSM RSSKPPQIEI  120
HEIGSTLEVV LISGLDNHQF MLTEIIRILH EEQADVVHAS LSTLGDSIFH VIRAEMGKSM  180
LDFGAAKITE KLRRFVDGST SDEELQREYL WDFEIYPETI WDQF
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
18898KRDSLKGNRKR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008228998.11e-167PREDICTED: transcription factor bHLH36-like
TrEMBLM5VT391e-146M5VT39_PRUPE; Uncharacterized protein
STRINGGLYMA06G44660.25e-74(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF9063498
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.15e-34bHLH family protein